| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
|
rp152075-10μg
|
10μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$99.90
|
|
|
rp152075-50μg
|
50μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$369.90
|
|
|
rp152075-100μg
|
100μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$599.90
|
|
|
rp152075-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$3,999.90
|
|
Animal Free, >97% (SDS-PAGE and HPLC), Active, E. coli, No tag, 24-94 aa
| Product Name | Recombinant Human TARC/CCL17 Protein, ＞97% (SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | CC chemokine TARC | Small-inducible cytokine A17 | Thymus and activation-regulated chemokine |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml. |
| Endotoxin Concentration | <0.01 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 24-94 aa |
| Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Protein Tag | No tag |
| Accession # | Q92583 |
| Predicted molecular weight | 8.1kDa |
| SDS-PAGE | 8.1kDa |
Recombinant Human TARC/CCL17(rp152075)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/mL.
Recombinant Human TARC/CCL17 Protein (rp152075)-SDS-PAGE
Recombinant Human TARC/CCL17 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 8.1 kDa under reducing conditionsand and 8.0-13.0kDa under non-reducing conditions.
| Shape | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600429 |
Certificate of Analysis | Mar 26, 2024 | rp152075 |
| ZJ23F0600428 |
Certificate of Analysis | Mar 26, 2024 | rp152075 |
| ZJ23F0600430 |
Certificate of Analysis | Jun 21, 2023 | rp152075 |
| 1. Bernardini G, Hedrick J, Sozzani S, Luini W, Spinetti G, Weiss M, Menon S, Zlotnik A, Mantovani A, Santoni A et al.. (1998) Identification of the CC chemokines TARC and macrophage inflammatory protein-1 beta as novel functional ligands for the CCR8 receptor.. Eur J Immunol, 28 (2): (582-8). [PMID:9521068] [10.1021/op500134e] |
| 2. Regenass P, Abboud D, Daubeuf F, Lehalle C, Gizzi P, Riché S, Hachet-Haas M, Rohmer F, Gasparik V, Boeglin D et al.. (2018) Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia.. J Med Chem, 61 (17): (7671-7686). [PMID:30106292] [10.1021/op500134e] |
| 3. Imai, T T and 5 more authors.. (1996) Molecular cloning of a novel T cell-directed CC chemokine expressed in thymus by signal sequence trap using Epstein-Barr virus vector.. The Journal of biological chemistry, (30): [PMID:8702936] |
| 4. Imai, T T and 5 more authors.. (1997) The T cell-directed CC chemokine TARC is a highly specific biological ligand for CC chemokine receptor 4.. The Journal of biological chemistry, (6): [PMID:9169480] |
| 5. Loftus, B J BJ and 18 more authors.. (1999) Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.. Genomics, (15): [PMID:10493829] |
| 6. Garlisi, C G CG and 6 more authors.. (1999) The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8.. European journal of immunology, [PMID:10540332] |
| 7. Asojo, Oluwatoyin A OA, Boulègue, Cyril C, Hoover, David M DM, Lu, Wuyuan W and Lubkowski, Jacek J.. (2003) Structures of thymus and activation-regulated chemokine (TARC).. Acta crystallographica. Section D, Biological crystallography, [PMID:12832759] |
| 8. Achuthan, Adrian A and 19 more authors.. (2016) Granulocyte macrophage colony-stimulating factor induces CCL17 production via IRF4 to mediate inflammation.. The Journal of clinical investigation, (1): [PMID:27525438] |
| 9. Hsu, Amy T AT and 6 more authors.. (2018) Epigenetic and transcriptional regulation of IL4-induced CCL17 production in human monocytes and murine macrophages.. The Journal of biological chemistry, (20): [PMID:29871928] |
We noticed your location and want to make sure you’re viewing the most relevant version of our site.
Would you like to be redirected to your local region’s page for a smoother experience?
