Skip to the beginning of the images gallery

Recombinant MPXV A30L Protein, ＞95% (SDS-PAGE), high purity

Animal Free

Carrier Free

Azide Free

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: Q8V4U9
Protein Tag: C-His

In stock

Item Number

rp155933

Grouped product items
SKU	Size	Availability	Price
rp155933-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp155933-50μg	50μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$399.90
rp155933-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$699.90
rp155933-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,298.90

Animal Free, >95% (SDS-PAGE), 293 cell, C-His tag, 26-146 aa

View related series

A30L (0) Accession#:Q8V4U9 (0) Gene ID:928965 (0)

Basic Description

Product Name	Recombinant MPXV A30L Protein, ＞95% (SDS-PAGE), high purity
Grade	Animal Free, Azide Free, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Envelope protein required for virus entry into host cell and for cell-cell fusion (syncytium formation). Description： Monkeypox is a zoonotic disease caused by monkeypox virus (MPXV), which is a member of orthopoxvirus genus. A30L protein is required for the association of electron-dense, granular, proteinaceous material with the concave surfaces of crescent membranes, an early step in viral morphogenesis. The A30L protein is believed to be located in the matrix between the core and membrane. In vivo and in vitro experiments provided evidence for the direct interaction of the A30L and G7L proteins and demonstrated that the stability of each one was dependent on its association with the other. A presumption was that the A30L protein is a key element in the linkage between the viral core and the membrane. And some data indicate that protein-protein interactions are needed for the association of the dense viroplasm with IV membranes. Of the two interacting proteins identified, the G7L protein appears to be a component of the core whereas the A30L protein may be a component of the matrix between the core and membrane.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	＞95% (SDS-PAGE)
Expression System	HEK293
Species	Monkeypox virus
Amino Acids	26-146 aa
Sequence	MIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVLENLYFQGHHHHHH
Protein Tag	C-His
Accession #	Q8V4U9
Predicted molecular weight	15.5 kDa
SDS-PAGE	25-30 kDa, reducing conditions; 23-28 kDa, non-reducing conditions

Images

SDS-PAGE: Recombinant MPXV A30L Protein (rp155933)

Recombinant MPXV A30L Protein (rp155933) - SDS-PAGE
3 μg/lane of Recombinant MPVX A30L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 25-30 kDa under reducing conditions and 23-28 kDa under non-reducing conditions.

Product Specifications

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -80°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0700579	Certificate of Analysis	Jul 14, 2023	rp155933
ZJ23F0700580	Certificate of Analysis	Jul 14, 2023	rp155933

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

Recombinant MPXV A30L Protein, ＞95% (SDS-PAGE), high purity

Basic Description

AI Insight