| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
|
rp155843-10μg
(Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! |
10μg |
4
|
$79.90
|
|
|
rp155843-100μg
|
100μg |
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
|
$379.90
|
|
|
rp155843-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,439.90
|
|
Carrier free , >95% (SDS-PAGE), E. coli, N-His tag, 58-181 aa
| Product Name | Recombinant MPXV A35R Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | A35R | OPG161 EEV glycoprotein | OPG161 | MPVX A35R | Monkeypox virus | Monkeypox virus A35R |
| Grade | Azide Free, Carrier Free |
| Product Description |
Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Expression System | E. coli |
| Species | Monkeypox virus |
| Amino Acids | 58-181 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMRQNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCT. |
| Protein Tag | N-His |
| Accession # | Q8V4U4 |
| Predicted molecular weight | 16.0 kDa |
| SDS-PAGE | 15.5 kDa, under reducing conditions; 33.0 kDa, under non-reducing conditions. |
Recombinant MPVX A35R Protein (rp155843) - SDS-PAGE
3 μg/lane of Recombinant MPVX A35R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 15.5 kDa under reducing conditions and 33.0 kDa under non-reducing conditions.
| Shape | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle. |
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0202930 |
Certificate of Analysis | Mar 01, 2024 | rp155843 |
| ZJ23F0700585 |
Certificate of Analysis | Jul 14, 2023 | rp155843 |
We have obtained your location, but we do not collect data on your location. Do we accept redirection to the corresponding region based on your location?
