| Description | Interleukin-6 receptor subunit alpha |
|---|
Gene and Protein Information
| Gene ID | 3570 |
|---|---|
| Uniprot Accession IDs | P08887 A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha |
| Ensembl ID | ENSG00000160712 |
| Symbol | IL6Q gp80 CD126 IL6RA IL6RQ IL-6RA IL-6R-1 |
| Chromosome | 1 |
| Family | Belongs to the type I cytokine receptor family. Type 3 subfamily. |
| Sequence |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Show more
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 469506 | IL6R | interleukin 6 receptor | 9598 | VGNC:1271 | OMA, EggNOG |
| Macaque | 716690 | IL6R | interleukin 6 receptor | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 16194 | Il6ra | interleukin 6 receptor, alpha | 10090 | MGI:105304 | Inparanoid, OMA, EggNOG |
| Rat | 24499 | Il6r | interleukin 6 receptor | 10116 | RGD:2902 | Inparanoid, OMA, EggNOG |
| Dog | 612271 | IL6R | interleukin 6 receptor | 9615 | VGNC:41993 | Inparanoid, OMA, EggNOG |
| Horse | 102148787 | IL6R | interleukin 6 receptor | 9796 | VGNC:19035 | Inparanoid, OMA, EggNOG |
| Cow | 507359 | IL6R | interleukin 6 receptor | 9913 | VGNC:30167 | Inparanoid, OMA, EggNOG |
| Pig | 399522 | IL6R | interleukin 6 receptor | 9823 | Inparanoid, EggNOG | |
| Opossum | 100020561 | IL6R | interleukin 6 receptor | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / signaling molecule / defense/immunity protein / Interleukin-6 receptor subunit alpha
protein / signaling molecule / cytokine / Interleukin-6 receptor subunit alpha
protein / signaling molecule / defense/immunity protein / Interleukin-6 receptor subunit alpha
protein / signaling molecule / cytokine / Interleukin-6 receptor subunit alpha
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
We noticed your location and want to make sure you’re viewing the most relevant version of our site.
Would you like to be redirected to your local region’s page for a smoother experience?