| Description | Tumor necrosis factor |
|---|
Gene and Protein Information
| Gene ID | 7124 |
|---|---|
| Uniprot Accession IDs | P01375 O43647 Q9P1Q2 Q9UIV3 |
| Ensembl ID | ENSG00000232810 |
| Symbol | TNFA TNFSF2 DIF TNFA TNFSF2 TNLG1F TNF-alpha |
| Chromosome | 6 |
| Family | Belongs to the tumor necrosis factor family. |
| Sequence |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 494186 | TNF | tumor necrosis factor | 9598 | Inparanoid, OMA | |
| Mouse | 21926 | Tnf | tumor necrosis factor | 10090 | MGI:104798 | Inparanoid, OMA |
| Rat | 24835 | Tnf | tumor necrosis factor | 10116 | RGD:3876 | Inparanoid, OMA |
| Dog | 403922 | TNF | tumor necrosis factor | 9615 | VGNC:47647 | Inparanoid, OMA |
| Horse | 100033834 | TNF | tumor necrosis factor | 9796 | VGNC:24357 | Inparanoid, OMA |
| Cow | 280943 | TNF | tumor necrosis factor | 9913 | VGNC:36153 | Inparanoid, OMA |
| Pig | 397086 | TNF | tumor necrosis factor | 9823 | Inparanoid, OMA | |
| Opossum | 100023069 | TNF | tumor necrosis factor | 13616 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / signaling molecule / tumor necrosis factor family member / Tumor necrosis factor
protein / signaling molecule / tumor necrosis factor family member / Tumor necrosis factor
DTO Classes
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
We noticed your location and want to make sure you’re viewing the most relevant version of our site.
Would you like to be redirected to your local region’s page for a smoother experience?